Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G075200.1
Common NamePOPTR_0014s07130g
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 824aa    MW: 89393.4 Da    PI: 6.2165
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G075200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
                         688999***********************************************999 PP

               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela++a++elvk+a+ +ep+W +s     e++n +e+l+++++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    +
                         5899*************************************99988999*9***************************.************ PP

               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksngh 161
                          +t++vi +g      g lqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd  ++ +  s+ +v +++lpSg+++++++ng+
                         ****************************************************************9999*********************** PP

               START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                         skvtw+eh+++++++ h+l+r+l++sg+ +ga++w atlqrq e
                         *****************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.216113173IPR001356Homeobox domain
SMARTSM003891.7E-17114177IPR001356Homeobox domain
CDDcd000862.04E-18115173No hitNo description
PfamPF000462.2E-18116171IPR001356Homeobox domain
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PROSITE profilePS5084843.961317554IPR002913START domain
SuperFamilySSF559614.0E-34319551No hitNo description
CDDcd088756.03E-122321550No hitNo description
SMARTSM002342.4E-46326551IPR002913START domain
PfamPF018521.4E-54326550IPR002913START domain
SuperFamilySSF559613.75E-23579749No hitNo description
SuperFamilySSF559613.75E-23776816No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 824 aa     Download sequence    Send to blast
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320755.10.0homeodomain family protein
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9IC550.0B9IC55_POPTR; Homeodomain family protein
STRINGPOPTR_0014s07130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein